Protein Info for BPHYT_RS03445 in Burkholderia phytofirmans PsJN

Annotation: cytochrome B561

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 186 transmembrane" amino acids 18 to 38 (21 residues), see Phobius details amino acids 54 to 72 (19 residues), see Phobius details amino acids 92 to 114 (23 residues), see Phobius details amino acids 119 to 130 (12 residues), see Phobius details amino acids 147 to 168 (22 residues), see Phobius details PF01292: Ni_hydr_CYTB" amino acids 13 to 183 (171 residues), 109.5 bits, see alignment E=8.5e-36

Best Hits

KEGG orthology group: K12262, cytochrome b561 (inferred from 100% identity to bpy:Bphyt_0706)

Predicted SEED Role

"Cytochrome B561"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2SX91 at UniProt or InterPro

Protein Sequence (186 amino acids)

>BPHYT_RS03445 cytochrome B561 (Burkholderia phytofirmans PsJN)
MALNPSFGNRESYTRTAVALHWLIALLIVCGFALGWVMTDIPGFTPTKLKYFSWHKWIGV
TVFALAVLRILWRATHAAPVMPRRMPVWQRGAAHLTHLLLYVLMIAIPASGYLYSSAANI
PVVYLGLIPLPRLIAPDPHLKELLKNVHITLNYTLLVLVALHVAAALKHQWLDRDGLLSR
MLPFLK