Protein Info for BPHYT_RS03310 in Burkholderia phytofirmans PsJN

Annotation: multidrug DMT transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 311 transmembrane" amino acids 14 to 33 (20 residues), see Phobius details amino acids 43 to 62 (20 residues), see Phobius details amino acids 74 to 99 (26 residues), see Phobius details amino acids 105 to 124 (20 residues), see Phobius details amino acids 134 to 154 (21 residues), see Phobius details amino acids 162 to 188 (27 residues), see Phobius details amino acids 200 to 221 (22 residues), see Phobius details amino acids 233 to 253 (21 residues), see Phobius details amino acids 261 to 280 (20 residues), see Phobius details amino acids 286 to 305 (20 residues), see Phobius details PF00892: EamA" amino acids 15 to 147 (133 residues), 60.8 bits, see alignment E=7.9e-21 amino acids 168 to 303 (136 residues), 67.3 bits, see alignment E=7.9e-23

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_0679)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2SX64 at UniProt or InterPro

Protein Sequence (311 amino acids)

>BPHYT_RS03310 multidrug DMT transporter permease (Burkholderia phytofirmans PsJN)
MSTPALPARRAPDSFAILLMVGLCAIWGLQQVAIKSTNAAVPPVFQAGLRSAIASVLVWV
WARSRGTPLFRDDGTLGAGLLAGVLFAGEFVCIFLGLTLTSASRMAVFLYTAPCFTALGL
HWFVDGERMRRIQWAGIVVAFAGISLAFADGFLHGPATGGSLLAGVAGDALGVLGGITWA
ATTVVVRATRLAQSSASKTLFYQLMVSAVVLLALALGLGQAHVETVTPLTVVSLAYQAVI
VAFVSYLLWFWLLTRYIASRLSVFSFLTPLFGVTFGVLLLGESFSLRFLMAAVLVLTGIA
LVNAPAKRVTG