Protein Info for BPHYT_RS03305 in Burkholderia phytofirmans PsJN

Annotation: ribosomal RNA small subunit methyltransferase A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 276 PF00398: RrnaAD" amino acids 15 to 272 (258 residues), 184.6 bits, see alignment E=9.9e-59 TIGR00755: ribosomal RNA small subunit methyltransferase A" amino acids 16 to 270 (255 residues), 246 bits, see alignment E=2e-77

Best Hits

Swiss-Prot: 100% identical to RSMA_PARPJ: Ribosomal RNA small subunit methyltransferase A (rsmA) from Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)

KEGG orthology group: K02528, 16S rRNA (adenine1518-N6/adenine1519-N6)-dimethyltransferase [EC: 2.1.1.182] (inferred from 100% identity to bpy:Bphyt_0678)

MetaCyc: 57% identical to 16S rRNA (A1518/A1519-N6-dimethyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-11633 [EC: 2.1.1.182]

Predicted SEED Role

"SSU rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))-dimethyltransferase (EC 2.1.1.182)" (EC 2.1.1.182)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.182

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2SX63 at UniProt or InterPro

Protein Sequence (276 amino acids)

>BPHYT_RS03305 ribosomal RNA small subunit methyltransferase A (Burkholderia phytofirmans PsJN)
MSTSRQQQGRHQGHIARKRFGQNFLVDMGVIDSIVDVIRPQRGERMVEIGPGLGALTEPL
IERLATPEAPLHAVELDRDLIGRLKTKFGGLLELHAGDALAFDFGSLAAPGEKASLRIVG
NLPYNISSPLLFHLTSFAHRVIDQHFMLQNEVVERMVAEPGTKAFSRLSVMLQYRYVIDK
QLDVPPEAFNPPPKVDSAIVRMIPYELHELAPVDERVLGEVVTAAFSQRRKMLRNTLAAY
RDSVDFEALGFDLQRRAEDVPVDEYVRVAQIVAAKA