Protein Info for BPHYT_RS03275 in Burkholderia phytofirmans PsJN

Annotation: metal ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 629 transmembrane" amino acids 37 to 58 (22 residues), see Phobius details amino acids 82 to 102 (21 residues), see Phobius details amino acids 163 to 185 (23 residues), see Phobius details amino acids 191 to 212 (22 residues), see Phobius details amino acids 275 to 296 (22 residues), see Phobius details amino acids 311 to 331 (21 residues), see Phobius details PF00664: ABC_membrane" amino acids 39 to 321 (283 residues), 143.2 bits, see alignment E=1.3e-45 PF00005: ABC_tran" amino acids 386 to 538 (153 residues), 111.2 bits, see alignment E=6.4e-36

Best Hits

Swiss-Prot: 49% identical to ATM1_CHAGB: Iron-sulfur clusters transporter ATM1, mitochondrial (ATM1) from Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970)

KEGG orthology group: K06147, ATP-binding cassette, subfamily B, bacterial (inferred from 100% identity to bpy:Bphyt_0672)

Predicted SEED Role

"Lipid A export ATP-binding/permease protein MsbA" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2SX57 at UniProt or InterPro

Protein Sequence (629 amino acids)

>BPHYT_RS03275 metal ABC transporter permease (Burkholderia phytofirmans PsJN)
MRRTPSSEPSPISTQPRNDWQTILSLLPYLATYKWRVGFALSCLIGAKVANLGVPIVMKR
IVDGLASVQHLTALGRAHDSPGIVLLGGIGLLVVAYAVVRLSTSLFTELREILFSKVTES
AVRQLALKVFRHLHALSLRFHLERQTGGMSRDIERGTRGITQLISYSLYSILPTLVEVGL
VLGFFVVKYEAYYAVVTFIALAVYIVFTVKVTEWRTHFRRTMNDLDSKANSRAIDSLLNY
ETVKYFGNEEWEASRYDENLKRYRTAAIKSQRSLSALNFGQQAIIGTGLVFILWRATQGV
MAGRLTLGDLVLINTFMLQLYIPLNFLGVVYRELKQSLTDMDRMFTLLGASQEVPDLEDA
PALRVSGAQVRFEHVNFAYEPARQILHDVSFTIPAGTTTAVVGHSGSGKSTLARLMFRFY
DLDRATGGAITIDGQDIRDVTQDSLRASIGIVPQDTVLFNDSIYYNIAYGRPSATRDEVI
AAARAAHIHEFIEGLPKGYETPVGERGLKLSGGEKQRVAIARTILKNPPILLFDEATSAL
DSRSERAIQHELDQIARERTTLIIAHRLSTVVHAQQIIVMDKGRIVERGTHAELLRANGL
FAQMWALQQQRAAEAPDAVETVSAGDGGR