Protein Info for BPHYT_RS03185 in Burkholderia phytofirmans PsJN

Annotation: thiopurine S-methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 207 transmembrane" amino acids 140 to 157 (18 residues), see Phobius details PF05724: TPMT" amino acids 20 to 203 (184 residues), 118.1 bits, see alignment E=4.8e-38 PF08241: Methyltransf_11" amino acids 58 to 113 (56 residues), 22.1 bits, see alignment E=2e-08

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_0653)

Predicted SEED Role

"SAM-dependent methyltransferases"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2SX39 at UniProt or InterPro

Protein Sequence (207 amino acids)

>BPHYT_RS03185 thiopurine S-methyltransferase (Burkholderia phytofirmans PsJN)
MSDPTQPSAPEFESRDPNSPEFWDERFERGFMPWDQAGVPSAFESFAARHAGAAVLIPGC
GSAYEAVWLAGHGYPVRAIDFSPAAVAAAHEQLGAQHADLVEQADFFTYELPFTPAWIYE
RAFLCALPLARRADYARRMADLLPGGALLAGFFFIGATPKGPPFGIERAELDGLLKPYFE
LIEDEPVHDSIAVFAGRERWLTWRRRV