Protein Info for BPHYT_RS02995 in Burkholderia phytofirmans PsJN

Annotation: 2-methylcitrate dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 470 PF03972: MmgE_PrpD_N" amino acids 13 to 249 (237 residues), 212 bits, see alignment E=8.2e-67 PF19305: MmgE_PrpD_C" amino acids 278 to 453 (176 residues), 144.3 bits, see alignment E=3.3e-46

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_0614)

Predicted SEED Role

"Immune-responsive protein 1"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2SXJ4 at UniProt or InterPro

Protein Sequence (470 amino acids)

>BPHYT_RS02995 2-methylcitrate dehydratase (Burkholderia phytofirmans PsJN)
MTSLDTSGTLSDQYARFGLGLQLSDVPRAVQTRAKHLILDAVGIAFASRGYPYADVSLAA
FAELGSGASPVIGYGRRLALRDSATMNGVLIHGLDFDDTHSRGVIHSTTSALPCVLALAD
RDGLSGADLLAAYIVAMEVSTRVASAAKGGFHDAGFHPTGLVGAFGCAVAASRLLQLDEA
RVAHAQGIVLSMAAGSLEFLEDGAWTKRAHPGFAAASAITAATLAKHGFTGPRLAYEGRF
GLYASHLGKPLDTAGRELATEGLGSTWQIDEVAIKPLPACHFTHAVADAAIALNREHRFS
ANSFDSIKRVVAKVPRGTVEIVCEPVDAKRKPVTAYDAQFSVPYIVATALLKGRFTLDEL
EPAALADPAVLALAAKVDYEIDPDTTFPRHYTGEVVVERSDGSRVAHREAINRGCADRPV
SNDDIVAKFYANAQRSVSRSAAEQIAQAVLQLDEQPARSLADTLAGHTAS