Protein Info for BPHYT_RS02975 in Burkholderia phytofirmans PsJN

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 385 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 44 to 64 (21 residues), see Phobius details amino acids 76 to 94 (19 residues), see Phobius details amino acids 100 to 121 (22 residues), see Phobius details amino acids 133 to 155 (23 residues), see Phobius details amino acids 162 to 182 (21 residues), see Phobius details amino acids 204 to 228 (25 residues), see Phobius details amino acids 241 to 261 (21 residues), see Phobius details amino acids 269 to 285 (17 residues), see Phobius details amino acids 291 to 309 (19 residues), see Phobius details amino acids 330 to 352 (23 residues), see Phobius details amino acids 358 to 376 (19 residues), see Phobius details PF07690: MFS_1" amino acids 13 to 344 (332 residues), 136.7 bits, see alignment E=9.2e-44 PF00083: Sugar_tr" amino acids 44 to 186 (143 residues), 29.6 bits, see alignment E=3.5e-11

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_0610)

Predicted SEED Role

"Putative transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2SXJ0 at UniProt or InterPro

Protein Sequence (385 amino acids)

>BPHYT_RS02975 membrane protein (Burkholderia phytofirmans PsJN)
MSAPELRATVSLAAIFALRMLGLFMIMPVFSIYAKTIPGGDNVLLVGIALGAYGVTQSML
YIFYGWVSDKVGRKPVIATGLLIFALGSFVAAGAHDMTWIIVGRVIQGMGAVSSAVIAFI
ADLTSEEHRTKAMAMVGGSIGVSFAVAIVGAPIVFQWVGMSGLFTLVGIFSILAIGVVLW
IVPDAPKPVHVRAPFAEVLHNVELLRLNFGVLVLHATQTALFLVVPRILEAGGLPVASHW
KVYLPVMGLSFVMMVPAIIAAEKRGKMKIVLLSAIALILIGQLLLGVAPHTILSVAAILF
VYFLGFNILEASQPSLVSKLAPGTRKGAAAGVYNTTQSIGLALGGVVGGWLLKVDGQSAV
FFTCSGLVLCWLIIAAKMKQPPRKA