Protein Info for BPHYT_RS02965 in Burkholderia phytofirmans PsJN

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 361 transmembrane" amino acids 32 to 50 (19 residues), see Phobius details amino acids 55 to 73 (19 residues), see Phobius details amino acids 87 to 109 (23 residues), see Phobius details amino acids 175 to 195 (21 residues), see Phobius details amino acids 229 to 248 (20 residues), see Phobius details amino acids 254 to 272 (19 residues), see Phobius details amino acids 279 to 302 (24 residues), see Phobius details amino acids 325 to 351 (27 residues), see Phobius details PF01594: AI-2E_transport" amino acids 41 to 353 (313 residues), 51.9 bits, see alignment E=3.5e-18

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_0608)

Predicted SEED Role

"membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2SXI8 at UniProt or InterPro

Protein Sequence (361 amino acids)

>BPHYT_RS02965 membrane protein (Burkholderia phytofirmans PsJN)
MAKRNQARDDGQVQDLRPRPVRLTSDMSLPKLSAVEIGSYIVTLFGMWAVIELRLLGALL
AGLLVFQLVHTIAPRIERHMSSKRARWLAVVILATVIVGALTGLTLGIIEHFENDVPSVQ
KLLDQAMQLIDQARGRIPQFVANYLPVDTEQMKTKAAELMQTHANMLQQSGKTAARAFTH
ILIGMIIGAIIAVGAQKHMQRLPLSTAFVTRVTRFADAFRRIVFAQVKISAINAVFTGIF
LLVILPIFHDTLPLSKTLVLVTFIVGLLPVIGNLISNTIIVAVALSVSFPAAVMSLVFLI
LIHKLEYFLNARIVGGQIEARAWELLIAMLIMEAAFGLPGVIAAPIFYAYIKRELIYLRL
V