Protein Info for BPHYT_RS02945 in Burkholderia phytofirmans PsJN

Annotation: lysine transporter LysE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 204 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details transmembrane" amino acids 37 to 63 (27 residues), see Phobius details amino acids 70 to 88 (19 residues), see Phobius details amino acids 113 to 133 (21 residues), see Phobius details amino acids 149 to 175 (27 residues), see Phobius details amino acids 182 to 202 (21 residues), see Phobius details PF01810: LysE" amino acids 13 to 202 (190 residues), 135 bits, see alignment E=1.2e-43

Best Hits

Swiss-Prot: 32% identical to RHTB_SALTY: Homoserine/homoserine lactone efflux protein (rhtB) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_0604)

Predicted SEED Role

"L-lysine permease" in subsystem Lysine degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2SXI4 at UniProt or InterPro

Protein Sequence (204 amino acids)

>BPHYT_RS02945 lysine transporter LysE (Burkholderia phytofirmans PsJN)
MPNFLLFLATSIAITMAPGPDNLQVLARGISQGRAAGLVAALGFAAGITFHTTLAALGVA
ALLRSSPVAFEVIKLAGAAYLIWIGIKALRSQGLATAHERAPQPLMAVFRQSVLGNLLNP
KVTLFFVVFLPQFVQPHGTQSVTLQMLELGVLFMLQTVAVFSLFGVCAGMIGGWLKRRPR
VGVWLDRLAGATFIAIGIRVALRD