Protein Info for BPHYT_RS02930 in Burkholderia phytofirmans PsJN

Annotation: KpsF/GutQ family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 327 PF01380: SIS" amino acids 44 to 175 (132 residues), 106.1 bits, see alignment E=1.2e-34 TIGR00393: sugar isomerase, KpsF/GutQ family" amino acids 48 to 317 (270 residues), 376.1 bits, see alignment E=5.3e-117 PF00571: CBS" amino acids 204 to 261 (58 residues), 36.6 bits, see alignment E=4.7e-13 amino acids 272 to 323 (52 residues), 40.6 bits, see alignment 2.6e-14

Best Hits

Swiss-Prot: 56% identical to KDSD_PSEAE: Arabinose 5-phosphate isomerase KdsD (kdsD) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K06041, arabinose-5-phosphate isomerase [EC: 5.3.1.13] (inferred from 100% identity to bpy:Bphyt_0601)

MetaCyc: 56% identical to D-arabinose 5-phosphate isomerase KdsD (Escherichia coli K-12 substr. MG1655)
Arabinose-5-phosphate isomerase. [EC: 5.3.1.13]

Predicted SEED Role

"Arabinose 5-phosphate isomerase (EC 5.3.1.13)" in subsystem KDO2-Lipid A biosynthesis (EC 5.3.1.13)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 5.3.1.13

Use Curated BLAST to search for 5.3.1.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2SXI1 at UniProt or InterPro

Protein Sequence (327 amino acids)

>BPHYT_RS02930 KpsF/GutQ family protein (Burkholderia phytofirmans PsJN)
MIAKINGDRALALARDVLDIEADAVRALRDQLDDGFVGAVDFILGCRGRVVVSGIGKSGH
VARKLAATLASTGTPAFFVHPAEASHGDLGMVTADDVFLALSNSGETEELVAILPLIKRL
GAKLIAMTGRPSSSLAQLADVHLNSGVSKEACPMNLAPTASTTAALALGDALAVAVLDAR
GFGRDDFARSHPGGALGRRLLTYVRDVMRTGDQVPKVTPDATVRDALFQLTAKRMGMTAI
VDHEDRVAGIFTDGDLRRVLERDGDFRELSIASVMTAGPRTIGPDQLAVEAVELMERHRI
NQMLVVDEAGKLIGALNMHDLFSKKVI