Protein Info for BPHYT_RS02875 in Burkholderia phytofirmans PsJN

Annotation: adenine glycosylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 353 TIGR01084: A/G-specific adenine glycosylase" amino acids 4 to 274 (271 residues), 357.7 bits, see alignment E=2.5e-111 PF00730: HhH-GPD" amino acids 34 to 166 (133 residues), 83.1 bits, see alignment E=2.7e-27 PF00633: HHH" amino acids 98 to 126 (29 residues), 38.4 bits, see alignment (E = 1e-13) PF14815: NUDIX_4" amino acids 236 to 346 (111 residues), 82 bits, see alignment E=4.1e-27

Best Hits

KEGG orthology group: K03575, A/G-specific adenine glycosylase [EC: 3.2.2.-] (inferred from 100% identity to bpy:Bphyt_0590)

Predicted SEED Role

"A/G-specific adenine glycosylase (EC 3.2.2.-)" in subsystem DNA repair, bacterial (EC 3.2.2.-)

Isozymes

Compare fitness of predicted isozymes for: 3.2.2.-

Use Curated BLAST to search for 3.2.2.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2SXH0 at UniProt or InterPro

Protein Sequence (353 amino acids)

>BPHYT_RS02875 adenine glycosylase (Burkholderia phytofirmans PsJN)
MSDFSTRLIAWQRQHGRHDLPWQNTRDPYRIWLSEIMLQQTQVSTVIPYYAKFLARFPTV
AALAAAPSDDVMALWAGLGYYTRARNLHRCAQVVIEQHGGAFPASVEELAELPGIGRSTA
AAIASFAFGARATILDGNVKRVLARVFGVEGFPGEKKVENAMWTLAESLLPSNASDADVS
AYTQGLMDLGATLCVRGKPDCLRCPFAADCVANVTGRQRVLPTARPKKTVPTRHTWMLVL
RDGNAVMLEKRPPSGIWGGLWSLPEAADEAALAERARAFGGDGAVSPLAPLTHVFTHFKL
DIEPRLAELDRGVGALAALGDADTAWVALSDLDSFGVPAPVRKLLDGLQGSLI