Protein Info for BPHYT_RS02860 in Burkholderia phytofirmans PsJN

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 210 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details TIGR00548: outer membrane lipoprotein LolB" amino acids 22 to 209 (188 residues), 82.9 bits, see alignment E=1.1e-27 PF03550: LolB" amino acids 55 to 210 (156 residues), 133.8 bits, see alignment E=2.7e-43

Best Hits

Swiss-Prot: 44% identical to LOLB_RALPJ: Outer-membrane lipoprotein LolB (lolB) from Ralstonia pickettii (strain 12J)

KEGG orthology group: K02494, outer membrane lipoprotein LolB (inferred from 100% identity to bpy:Bphyt_0587)

Predicted SEED Role

"Outer membrane lipoprotein LolB precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2SXG7 at UniProt or InterPro

Protein Sequence (210 amino acids)

>BPHYT_RS02860 membrane protein (Burkholderia phytofirmans PsJN)
MRLSRLIYFPRAPRGAALAFTAAAVVALAGCASVKPQGPSTSNAATSVTAQTSRAYQGRF
AVQYNDQNGQQRNAYGNFTWQETGDTVTLQLRNPLGQTLAVVTSSPASATLELPNRQPLT
ADNVSTLMQNALGFALPVEGLRYWLQPSPAPTSRARTEKDPEQPSRLKQITQDGWTIDYL
AYADAPAIGVKRVNLSRSEPPLDIKLVLDQ