Protein Info for BPHYT_RS02720 in Burkholderia phytofirmans PsJN

Annotation: MarR family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 308 transmembrane" amino acids 214 to 234 (21 residues), see Phobius details PF01047: MarR" amino acids 37 to 93 (57 residues), 42 bits, see alignment E=2e-14 PF12802: MarR_2" amino acids 37 to 93 (57 residues), 39.9 bits, see alignment E=1.1e-13 PF13463: HTH_27" amino acids 40 to 102 (63 residues), 31.6 bits, see alignment E=4.8e-11 PF00583: Acetyltransf_1" amino acids 193 to 284 (92 residues), 50.6 bits, see alignment E=6.8e-17 PF13673: Acetyltransf_10" amino acids 202 to 290 (89 residues), 34.8 bits, see alignment E=4.4e-12 PF13508: Acetyltransf_7" amino acids 204 to 285 (82 residues), 45.6 bits, see alignment E=2.2e-15

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_0559)

Predicted SEED Role

"Histone acetyltransferase HPA2 and related acetyltransferases"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2SXD9 at UniProt or InterPro

Protein Sequence (308 amino acids)

>BPHYT_RS02720 MarR family transcriptional regulator (Burkholderia phytofirmans PsJN)
MTDSEALRRAQAVRHFNRFYTRHIGALHEHLAKSAFSLTEVRVLHELSRERAQTASVLGR
SLGLDSGYLSRLLTSFERRDLITRRPSETDARQSLIALTDSGHAAYAPLDNAAIEEVSIL
LSGLTALSQDQLIAAMKLIERLLGDKPKHELVVLRQPRPGECGWLVHRQAQWFAAQYDWD
PSFEGLLARVVADYTQRNDPVREMCWVADQQGMVVGSVCIVGVSTTVAGVRLLWVEPDVQ
RLGIGTQLLSECMRFAKRAGYTKLTLTTAASLEQPRRLCQRAGFRLAGTAAERRFGKDLT
IERWELGL