Protein Info for BPHYT_RS02535 in Burkholderia phytofirmans PsJN

Annotation: magnesium chelatase subunit ChlI

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 532 PF13541: ChlI" amino acids 21 to 132 (112 residues), 141.4 bits, see alignment E=3.9e-45 TIGR00368: Mg chelatase-like protein" amino acids 156 to 526 (371 residues), 386.3 bits, see alignment E=1e-119 PF01078: Mg_chelatase" amino acids 220 to 425 (206 residues), 306 bits, see alignment E=3.4e-95 PF00493: MCM" amino acids 238 to 380 (143 residues), 37.8 bits, see alignment E=3.5e-13 PF13335: Mg_chelatase_C" amino acids 434 to 526 (93 residues), 101.8 bits, see alignment E=8e-33

Best Hits

KEGG orthology group: K07391, magnesium chelatase family protein (inferred from 100% identity to bpy:Bphyt_0523)

Predicted SEED Role

"MG(2+) CHELATASE FAMILY PROTEIN / ComM-related protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2SX04 at UniProt or InterPro

Protein Sequence (532 amino acids)

>BPHYT_RS02535 magnesium chelatase subunit ChlI (Burkholderia phytofirmans PsJN)
MSLAVVRSRAPASGRAPEVTVEVHLANGLPSFSIVGLPDLEVRESRERVRAALQNCNFDF
PVRRITVNLAPADLPKESGRFDLPIALGILAASGQIPAESLLHREFAGELSLTGALRPMR
GAFAMACGTARSAVAQGGGALQSAASAGELVAGDARAHATPQLYLPAASAAEAALVPGVD
VYGAADLPSLCAHLAQAPDGRLYPVAAPDLAENPAAIVPDMGDVIGQRGARRALEVAAAG
GHHVLLVGPPGAGKSMLAARLPGLLPPMTDDEALASAALLSASRAGFTPSQWRRRPFRAP
HHSSSAAALVGGRNPPQPGEITLAHLGVLFLDELPEFDRHVLETLREPLEAGRITISRAA
LQADFPAACQLIAAMNPCPCGWRGDPNGRCRCTPEIAARYLRKLSGPLLDRIDIQLEVPA
LTPAELSARSMAAGETSAAIAARVSRARERQLNRQGKTNRELGGREVDEVCRPDSAGEAL
LREAGERFGWSARAYYRVLKVARSIADLAGAPMPSAAQIGEAIQYRRAFGSL