Protein Info for BPHYT_RS02465 in Burkholderia phytofirmans PsJN

Annotation: taurine ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 289 transmembrane" amino acids 38 to 57 (20 residues), see Phobius details amino acids 99 to 123 (25 residues), see Phobius details amino acids 136 to 155 (20 residues), see Phobius details amino acids 161 to 180 (20 residues), see Phobius details amino acids 220 to 242 (23 residues), see Phobius details amino acids 256 to 275 (20 residues), see Phobius details PF00528: BPD_transp_1" amino acids 113 to 282 (170 residues), 87.5 bits, see alignment E=5e-29

Best Hits

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 100% identity to bpy:Bphyt_0509)

Predicted SEED Role

"Taurine transport system permease protein TauC" in subsystem Taurine Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2SWZ0 at UniProt or InterPro

Protein Sequence (289 amino acids)

>BPHYT_RS02465 taurine ABC transporter permease (Burkholderia phytofirmans PsJN)
MTASRESLGDLPLAQTGKRPRQTGRPVHGWRLPGEGPTAVLSALSVTTLAALWWLATHLH
WLPPLFLPTPEAVWTAFLDAWHGRIQGGLPLSQHLAWSALRVFGAFALAALTAVPVGILM
GVSRVARGLLDPPLEFYRPLPPLAYLPLVVIWFGIDETAKIVVIYLACFAPIAMAARAGV
RSATIEQIHAAYSLGGRFSQIVRHVVLPAALPEILTGLRIAIGFGWTTLVAAEMVAATAG
LGQMVLNASSFLRTDVVVMGIVLIGLIAWLFDLGMRVLERRLVPWKGRV