Protein Info for BPHYT_RS02395 in Burkholderia phytofirmans PsJN

Annotation: ABC transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 208 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF03886: ABC_trans_aux" amino acids 45 to 195 (151 residues), 70.2 bits, see alignment E=8e-24

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_0494)

Predicted SEED Role

"Probable lipoprotein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2SWX5 at UniProt or InterPro

Protein Sequence (208 amino acids)

>BPHYT_RS02395 ABC transporter (Burkholderia phytofirmans PsJN)
MSRSIHRFLPTSAALAVLLAFGVLAAGCAGTPAALSDIRYDFGPPSPAASAGTSPAVKVL
DVSAPDVLESDKLMYRLSYADAQQTAAYANSHWTMTPSQLLTQRLRGALSSRGTVLTGAD
GVAAPVLKVDLSEFEQVFDSQSESHAAVTARATLTQSGKVLSQRTFIARAPSRSADAAGG
AQALATASDDLVSQIGAWLGVQALVAAQ