Protein Info for BPHYT_RS02020 in Burkholderia phytofirmans PsJN

Annotation: filamentous hemagglutinin family outer membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 812 signal peptide" amino acids 1 to 41 (41 residues), see Phobius details PF05860: TPS" amino acids 46 to 305 (260 residues), 186.5 bits, see alignment E=4.4e-59 TIGR01901: filamentous hemagglutinin family N-terminal domain" amino acids 81 to 177 (97 residues), 55.7 bits, see alignment E=3.5e-19 TIGR01731: adhesin HecA family 20-residue repeat (two copies)" amino acids 310 to 348 (39 residues), 11.9 bits, see alignment 1.8e-05 amino acids 328 to 366 (39 residues), 17.2 bits, see alignment 4.1e-07 amino acids 487 to 525 (39 residues), 11.2 bits, see alignment 3.1e-05 amino acids 505 to 544 (40 residues), 16.8 bits, see alignment 5.2e-07 amino acids 544 to 581 (38 residues), 10.2 bits, see alignment 6.4e-05 amino acids 584 to 621 (38 residues), 13.5 bits, see alignment 5.9e-06 amino acids 624 to 660 (37 residues), 9.3 bits, see alignment (E = 0.00012) amino acids 651 to 685 (35 residues), 17.2 bits, see alignment (E = 4e-07) amino acids 665 to 704 (40 residues), 24.2 bits, see alignment 2.6e-09 amino acids 686 to 724 (39 residues), 9.4 bits, see alignment 0.00011

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_0418)

Predicted SEED Role

"Putative large exoprotein involved in heme utilization or adhesion of ShlA/HecA/FhaA family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2SWP9 at UniProt or InterPro

Protein Sequence (812 amino acids)

>BPHYT_RS02020 filamentous hemagglutinin family outer membrane protein (Burkholderia phytofirmans PsJN)
MQKTPPRIIDSKSRTVWFAARASAFAALCAFGMQPLVASAQAKLTITPDAGAATRPTIGT
SSNGTQVVNIVAPNAAGVSSNRFSDYNVGTGGVIINNATQAAQTQIGGTVQANSVLGKQG
AKLVLMQVTSGAQSQLLGTTEIAGNSANLVLANPAGITCSGCGFLNAPRVTLATGTPTLK
SDGSLDTIDVKQGTLAVDGGGLNGSTSAVDLIARAITINGKVQGKSIDAIAGANRVNYAS
KSALAQAGTGSAPQVAIDVQSLGSMYGDGAVRLLGTEAGVGVRDNGTLTSLTGNLSVGAN
GDVTIAVPASIKAAGNAAINGANVTNDGSIAASGSMDVHATQALANRGTITADSMSLIAN
TLSNAGKVAANGIRMGGDRSLINTGTIEAAQQAELAGDSMTLAADSSVNSANVTLRGGTI
TNQSNAVNASRFLNINADHIDNAGTLSSGGGAYVNAMSTFANGANGTLTAQDNVQIGGGN
VTNDDLIASARSLDANGALSLTNRGTLTAGDAMNLSTRGSLLNSGKMSAASLSMTADQSL
TNSGTIDATTQATLASNNLMLSGGSVKGGTVTLNGGTVTNQNATVNAGQLLDIRADNVEN
TGTLSSNGDARVNAMNTFMNGANGTLTAQNNVQIGGTTLNNSNGSIEAVKGTLSVQASTI
ANLNGKLSSGNAMSINTRGDLDNTGGTITAGRDGQIDVGGKLTNDNGSITSQAAVRGTAG
SMSNVGGTISAPISAEIRVVGDNDRNNGGFIPPVNPTPEPERTPAPKPEPTPTTFVPPPG
FVRMDPHSPDLNKYSGFYDQDGYFYARIFMPS