Protein Info for BPHYT_RS01865 in Burkholderia phytofirmans PsJN

Annotation: major facilitator transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 430 transmembrane" amino acids 12 to 42 (31 residues), see Phobius details amino acids 50 to 76 (27 residues), see Phobius details amino acids 83 to 102 (20 residues), see Phobius details amino acids 121 to 139 (19 residues), see Phobius details amino acids 153 to 172 (20 residues), see Phobius details amino acids 184 to 205 (22 residues), see Phobius details amino acids 236 to 257 (22 residues), see Phobius details amino acids 272 to 292 (21 residues), see Phobius details amino acids 302 to 323 (22 residues), see Phobius details amino acids 333 to 355 (23 residues), see Phobius details amino acids 367 to 388 (22 residues), see Phobius details amino acids 399 to 417 (19 residues), see Phobius details PF00083: Sugar_tr" amino acids 13 to 223 (211 residues), 94.2 bits, see alignment E=8.7e-31 amino acids 222 to 413 (192 residues), 33.7 bits, see alignment E=2e-12 PF07690: MFS_1" amino acids 45 to 282 (238 residues), 56.4 bits, see alignment E=2.4e-19 amino acids 281 to 415 (135 residues), 39.8 bits, see alignment E=2.8e-14

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_0389)

Predicted SEED Role

"Permeases of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T1T2 at UniProt or InterPro

Protein Sequence (430 amino acids)

>BPHYT_RS01865 major facilitator transporter (Burkholderia phytofirmans PsJN)
MTPASRSLHTRAVVAAVIGNALEWYDFTVFGFLTVVIAQLFFPAGNDYSSLLLATATFGV
AFVMRPIGGIVLGLYADRAGRKAALSLVIALMTLGILLLAIAPPYSAIGIGAPLMIVVGR
SLQGFSAGGEFGSSTALLIEAAPFSKRGFYGSWQMASQAAALLLGALVGAAITRGLSPEA
LKSWGWRVPFILGLIIGPIGFYIRLHLADSEAFLLAQKTARRATLGEVFRTHARDVLCGL
GSVIALTVTIYVLISYLPTFAVNQLKLPYAQSFYAVIVGNLLLTVLSPVAGAWSDRIGRK
GLSLWSLLITLVIIYPLFAWLAAEPSVSKLILVQALLSITLSGYYGPFGALIAELFPANV
RSTGLSLAYNIAVMVFGGFGPFVVTWLINITGSPLAPTYYVMGGLALSIVAVACIPGQRH
ADLDAHRKPA