Protein Info for BPHYT_RS01815 in Burkholderia phytofirmans PsJN

Annotation: sugar ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 336 transmembrane" amino acids 38 to 56 (19 residues), see Phobius details amino acids 64 to 83 (20 residues), see Phobius details amino acids 90 to 109 (20 residues), see Phobius details amino acids 115 to 137 (23 residues), see Phobius details amino acids 144 to 163 (20 residues), see Phobius details amino acids 179 to 204 (26 residues), see Phobius details amino acids 235 to 255 (21 residues), see Phobius details amino acids 262 to 282 (21 residues), see Phobius details amino acids 288 to 307 (20 residues), see Phobius details amino acids 313 to 331 (19 residues), see Phobius details PF02653: BPD_transp_2" amino acids 65 to 328 (264 residues), 117.9 bits, see alignment E=2.4e-38

Best Hits

KEGG orthology group: K10440, ribose transport system permease protein (inferred from 100% identity to bpy:Bphyt_0379)

Predicted SEED Role

"putative sugar uptake ABC transporter permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T1S5 at UniProt or InterPro

Protein Sequence (336 amino acids)

>BPHYT_RS01815 sugar ABC transporter permease (Burkholderia phytofirmans PsJN)
MHTEPRLGETAQQITAAPPASAATTVRKWRHLAMQREVIVLLAMVLFNLIFTPHFWSLQT
FNVNMTQVVTIVIVGIGMTLVVATGGIDLSVGASMAISGALAPMLFLNIAGPGGIALAFV
LPVLAAALCGVFNGLLVTRLSVQPIVATLVLFIAGRGIAQVVTDGSLQAFNTPAFQWIAL
GKVAGVPFQVLLMLALVGLFAWVVRKTLFGQYLLITGGNEKAAYLCGVPTATVKLIAYTL
CAALAGLAGLISISVNSSSDANVVGLGVELDAIAAVAVGGTALTGGKAYIGGTLIGALII
QLLRYTLLAHGIPDAAALVVKAGIIVAAVYVQRRSR