Protein Info for BPHYT_RS01810 in Burkholderia phytofirmans PsJN

Annotation: sugar ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 319 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 34 to 53 (20 residues), see Phobius details amino acids 59 to 77 (19 residues), see Phobius details amino acids 82 to 101 (20 residues), see Phobius details amino acids 108 to 128 (21 residues), see Phobius details amino acids 149 to 170 (22 residues), see Phobius details amino acids 200 to 224 (25 residues), see Phobius details amino acids 230 to 248 (19 residues), see Phobius details amino acids 255 to 273 (19 residues), see Phobius details amino acids 285 to 304 (20 residues), see Phobius details PF02653: BPD_transp_2" amino acids 33 to 299 (267 residues), 145.2 bits, see alignment E=1.1e-46

Best Hits

KEGG orthology group: K10440, ribose transport system permease protein (inferred from 100% identity to bpy:Bphyt_0378)

Predicted SEED Role

"Ribose ABC transport system, permease protein RbsC (TC 3.A.1.2.1)" in subsystem D-ribose utilization (TC 3.A.1.2.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T1S4 at UniProt or InterPro

Protein Sequence (319 amino acids)

>BPHYT_RS01810 sugar ABC transporter permease (Burkholderia phytofirmans PsJN)
MKKNLPILLALAALVVFGLVRYEHFGSAYNITSFWRYNSMFALISVGMAFVIITGGIDLS
VGTVAALASVVAALTSVYGGWVAVLAGCGAGLAVGVLNGLIITRLKILPFIVTLATSLGA
HGVALLLGKNDAVSIAAESNFGNFGQGDLFGLPIPGIVAVVAAVAGWLALRSTRFGRHSL
AIGGSEEAARLMGLNVDRTLVMAYAVSGLLAGMAGVILAAQFGAGQPNEGVGWELFAISA
VVLGGTLLTGGEGSIAMTIAGVLLLGLVFNLLNFENGLGFISLSAYWQSVIRGVFLLLVI
VLQARVLKQRGRKRVAAPA