Protein Info for BPHYT_RS01710 in Burkholderia phytofirmans PsJN

Annotation: RND transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 509 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details TIGR01845: efflux transporter, outer membrane factor (OMF) lipoprotein, NodT family" amino acids 28 to 483 (456 residues), 423.9 bits, see alignment E=4.1e-131 PF02321: OEP" amino acids 84 to 274 (191 residues), 78.9 bits, see alignment E=2.2e-26 amino acids 300 to 481 (182 residues), 68.9 bits, see alignment E=2.6e-23

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_0358)

Predicted SEED Role

"Heavy metal RND efflux outer membrane protein, CzcC family" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T1Q4 at UniProt or InterPro

Protein Sequence (509 amino acids)

>BPHYT_RS01710 RND transporter (Burkholderia phytofirmans PsJN)
MNTPRSCRRVVAAPLRCVSLLASALALASACALTACTLGPDYVKPTATTAATYKELDGTG
WKPAQPADTLTRGAWWSVYADPSLDALEQQVASANQNVQAAEARFRAARATVAQYRSSFF
PVVSANGAYSRARSSENVLHKSTAGLTLNDYLVQADASWEPDLWGRVSRSVEGAKAEAQA
SAADAQAALLSMQAELATDYFELRGLDQERQLLDDTIEAYKQALDLTQHRYTGGIATDAD
VAQAQTQLKTTQAQALDLGVQRAQLEHAIAILIGQSPSTFSLPVAPLTAVPIVAAAGVPS
ALLERRPDIAAAERHVADMNAQIGVATAAFFPNLILSVTGGLEATNYSQWLLAPSRLWSL
GPTLAGTLLDFGGRASVKEQARAHYDESVAQYRQTVLSAFGQVEDNLAALRVLEQEATAQ
DDAVAAAQRALAVVSNRYKNGAITYLDVVVAQTTALTNERNAVSIARRRMAASVALIKAL
GGGWDASALPTDEQIVHPSAPASDAAAHG