Protein Info for BPHYT_RS01470 in Burkholderia phytofirmans PsJN

Annotation: protease HtpX homolog

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 285 transmembrane" amino acids 7 to 25 (19 residues), see Phobius details amino acids 31 to 48 (18 residues), see Phobius details amino acids 141 to 164 (24 residues), see Phobius details amino acids 177 to 197 (21 residues), see Phobius details PF01435: Peptidase_M48" amino acids 68 to 278 (211 residues), 124 bits, see alignment E=3.4e-40

Best Hits

Swiss-Prot: 100% identical to HTPX_PARPJ: Protease HtpX homolog (htpX) from Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)

KEGG orthology group: K03799, heat shock protein HtpX [EC: 3.4.24.-] (inferred from 100% identity to bpy:Bphyt_0312)

Predicted SEED Role

"Peptidase M48, Ste24p precursor"

Isozymes

Compare fitness of predicted isozymes for: 3.4.24.-

Use Curated BLAST to search for 3.4.24.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T1K8 at UniProt or InterPro

Protein Sequence (285 amino acids)

>BPHYT_RS01470 protease HtpX homolog (Burkholderia phytofirmans PsJN)
MFNWVKTAMLMAAITALFIVIGGMIGGSRGMTIALVIALGMNFFSYWFSDKMVLRMYNAQ
EVDETSAPQFYRMVRELSTRAGLPMPRVYLINEDAPNAFATGRNPEHAAVAATTGILRVL
SEREMRGVMAHELSHVKHRDILISTISATMAGAISALANFAMFFGSRDENGRSTNPIAGI
AVALLAPIAGALIQMAISRAREFEADRGGAQISGDPQALASALDKIHRYASGIPFPTAEQ
HPATAQMMIMNPLSGGGIANLFSTHPATEERIARLMEMARTGRFE