Protein Info for BPHYT_RS00825 in Burkholderia phytofirmans PsJN

Annotation: DNA replication protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 637 PF08707: PriCT_2" amino acids 13 to 83 (71 residues), 60.6 bits, see alignment E=8e-21

Best Hits

KEGG orthology group: K06919, putative DNA primase/helicase (inferred from 100% identity to bpy:Bphyt_0173)

Predicted SEED Role

"DNA primase TraC (EC 2.7.7.-)" in subsystem DNA-replication (EC 2.7.7.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.-

Use Curated BLAST to search for 2.7.7.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T051 at UniProt or InterPro

Protein Sequence (637 amino acids)

>BPHYT_RS00825 DNA replication protein (Burkholderia phytofirmans PsJN)
MNTRYLSEEERARAALAMIPSGDYATWVDMAFALKQGFGEAGFDIWDEWSRTAHNYSERA
ARVTWRSAGESGGKTLASLFWLAQQHGFDVRASRAAMDPADRSRMQPIRPSEEQARQGAQ
LEARVRARQEAVAREALAIWKWARPVGPDHPYLERKQVRPVPALRELEAEELHALLGYAP
RSAEEPLTGRVLVVPVRIGDALSTLELIDADGRKSALAGGAKSGGCWVVEPGQFREGAVT
PVLIAEGVATALAAWQATGWFSVAALSSGNLRPVAAMWRGRYPEAEVLVLADLGAGYEHA
KQAALGTSSLLAEPRFASDARIAGAIPTDFDDMAVLSGTGAVGDLLRESLYGVRVRDATG
AEVDGPVAVAQGAEGVLKEDHAMGNVKEKLVGDGEASGRRRTSRRRAGHQDAPEPAPQDS
TAPEPATEQPQSQSQSPEPVPEQRETDAPKPARMSARDAEPPARRRVGEPLYGFDEVPGE
IKALAQHRFGAQIRMATPRENGGPYRGEVFNTEHYLIQEVSTRSVVFHAKSNMEFVSDRL
RWMDENQRLNGAEVQVGYDGARAKVYPWDRARDLLERTVASLKKSAREVGFGSELDATLD
QLQTISWTRVREARAAALAQSKERAGREQEQGPGPQR