Protein Info for BPHYT_RS00770 in Burkholderia phytofirmans PsJN

Annotation: conjugal transfer protein TraC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 113 signal peptide" amino acids 1 to 45 (45 residues), see Phobius details transmembrane" amino acids 60 to 77 (18 residues), see Phobius details amino acids 89 to 110 (22 residues), see Phobius details PF04956: TrbC" amino acids 25 to 109 (85 residues), 53.6 bits, see alignment E=1.1e-18

Best Hits

Swiss-Prot: 35% identical to PTLA_BORBR: Type IV secretion system protein PtlA homolog (ptlA) from Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)

KEGG orthology group: K03197, type IV secretion system protein VirB2 (inferred from 100% identity to bpy:Bphyt_0161)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T039 at UniProt or InterPro

Protein Sequence (113 amino acids)

>BPHYT_RS00770 conjugal transfer protein TraC (Burkholderia phytofirmans PsJN)
MKSGLRMIWRWLPERLEKPGTARPSRRGLALLPVLALTVTPAWAQLSQVNTLLTTIQTTL
LSVGAVVCSISIIWAGFKMMFQHARFGDIANVFIGGLFVGCATVIAAMLIPTS