Protein Info for BPHYT_RS00695 in Burkholderia phytofirmans PsJN

Annotation: branched-chain amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 291 transmembrane" amino acids 7 to 28 (22 residues), see Phobius details amino acids 36 to 36 (1 residues), see Phobius details amino acids 42 to 50 (9 residues), see Phobius details amino acids 58 to 80 (23 residues), see Phobius details amino acids 92 to 113 (22 residues), see Phobius details amino acids 134 to 154 (21 residues), see Phobius details amino acids 186 to 207 (22 residues), see Phobius details amino acids 220 to 243 (24 residues), see Phobius details amino acids 255 to 272 (18 residues), see Phobius details TIGR03409: urea ABC transporter, permease protein UrtB" amino acids 4 to 278 (275 residues), 252.4 bits, see alignment E=3.8e-79 PF02653: BPD_transp_2" amino acids 4 to 269 (266 residues), 144.4 bits, see alignment E=1.9e-46

Best Hits

KEGG orthology group: K01997, branched-chain amino acid transport system permease protein (inferred from 100% identity to bpy:Bphyt_0146)

Predicted SEED Role

"Branched-chain amino acid ABC-type transport system, permease components"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T024 at UniProt or InterPro

Protein Sequence (291 amino acids)

>BPHYT_RS00695 branched-chain amino acid ABC transporter permease (Burkholderia phytofirmans PsJN)
MTTILNILGYVSILILVALGLAIVFGMMDIVNLAHAEWVTIGAYALAVAQAVGGQQAFWL
ALFAAPAVGAFLGWCLERFIIRLLYDRPLDTLLATYAISLILQKVLELIFGTQPMLVYAP
FSGAVPVPGGSYPAYRIFVIGVALTVTAGCWLLFARTRFGTQLRAVIQHPAMAEAAGIDT
RRLNRIAFCGGAALASLAGVLVAPMVSVESHLGVSYLAKAFFVIVLGGIGSIAGSILGSA
VIGTAETLLSYRIDPSLASAVVLVLSIVVIRFRPQGLIPGFSAAHQLLGKG