Protein Info for BPHYT_RS00525 in Burkholderia phytofirmans PsJN

Annotation: aldehyde dismutase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 404 PF08240: ADH_N" amino acids 37 to 145 (109 residues), 90.3 bits, see alignment E=7.3e-30 PF00107: ADH_zinc_N" amino acids 204 to 315 (112 residues), 36 bits, see alignment E=6.2e-13

Best Hits

Swiss-Prot: 52% identical to FDM_PSEPU: Formaldehyde dismutase (fdm) from Pseudomonas putida

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_0111)

Predicted SEED Role

"Threonine dehydrogenase and related Zn-dependent dehydrogenases" in subsystem Threonine degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2SZZ2 at UniProt or InterPro

Protein Sequence (404 amino acids)

>BPHYT_RS00525 aldehyde dismutase (Burkholderia phytofirmans PsJN)
MAQPGNRIVTFEKPMEMKVNTFKFPELITPQGKSAPHGAILKIVTTNICGSDLHIYRGSF
PVPKGMTMGHEMTGEVIEVGSDVEFIKKGDVVSVPFNVGCGRCYNCKHMRSEVCENTNTD
VDCGAYGFNLGGWTGGQGDYLFVPYADFNLLRFPDKDAAMEKIRDLTLLSDVLPTAFHGF
AAPDWPAAPAYIVGENVLIFGAGPVGRAGAACAKLLGAGAIVVADFIPERLDLLKPHGIE
TINLSDGTPIEDHLERITGHREVDRVIDYVGVDCRGFGPDAGKIVENAVTNAMLKYVRAG
GTTSTVGVYCANPISKDAAAKAGHMDLEWSNAWIKSPRMAAGQSPTANYNRALMRAILND
RMPYLTPMMNIKFIKLEDAPQAYKDFDAGSAYKYVIDPHGSVKH