Protein Info for BPHYT_RS00160 in Burkholderia phytofirmans PsJN

Annotation: ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 262 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF00497: SBP_bac_3" amino acids 29 to 255 (227 residues), 119.1 bits, see alignment E=1.1e-38 PF09084: NMT1" amino acids 105 to 182 (78 residues), 28.5 bits, see alignment E=1.4e-10

Best Hits

Swiss-Prot: 44% identical to HISJ_SALTY: Histidine-binding periplasmic protein (hisJ) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K10013, lysine/arginine/ornithine transport system substrate-binding protein (inferred from 100% identity to bpy:Bphyt_0032)

Predicted SEED Role

"Lysine-arginine-ornithine-binding periplasmic protein precursor (TC 3.A.1.3.1)" in subsystem Arginine and Ornithine Degradation (TC 3.A.1.3.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2SZA5 at UniProt or InterPro

Protein Sequence (262 amino acids)

>BPHYT_RS00160 ABC transporter substrate-binding protein (Burkholderia phytofirmans PsJN)
MKLLKPLLALACAFASLAASSGASAADTLRFGLEAQYPPFESKGPNGELQGLDIDVGNAV
CVAAHMTCKWVETSFDGLIPALQGRKFDAINSAMNATDARRQAIDFTTVVYRVPTQLIAK
RDSGLLPTPASLKGKRVGVLQASIQETYAKAHWESAGVTVVPYQDQNQVYTDLVAGRLDA
TLVLAPAGQTGFLSKPSGEGYAFVGEPVRDDKILGSGIAYGIRKGDTALRDRLNAAIAKV
QADGTVKTLAAKYLGNIDVSAK