Protein Info for BPHYT_RS00100 in Burkholderia phytofirmans PsJN

Annotation: ethanolamine permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 467 transmembrane" amino acids 22 to 43 (22 residues), see Phobius details amino acids 50 to 73 (24 residues), see Phobius details amino acids 100 to 125 (26 residues), see Phobius details amino acids 137 to 158 (22 residues), see Phobius details amino acids 163 to 183 (21 residues), see Phobius details amino acids 204 to 227 (24 residues), see Phobius details amino acids 239 to 261 (23 residues), see Phobius details amino acids 290 to 312 (23 residues), see Phobius details amino acids 339 to 356 (18 residues), see Phobius details amino acids 368 to 391 (24 residues), see Phobius details amino acids 405 to 426 (22 residues), see Phobius details amino acids 428 to 428 (1 residues), see Phobius details amino acids 432 to 450 (19 residues), see Phobius details TIGR00908: ethanolamine permease" amino acids 15 to 463 (449 residues), 711.1 bits, see alignment E=2.8e-218 PF13520: AA_permease_2" amino acids 22 to 431 (410 residues), 144.2 bits, see alignment E=5.8e-46 PF00324: AA_permease" amino acids 31 to 434 (404 residues), 128.5 bits, see alignment E=3.2e-41

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_0020)

Predicted SEED Role

"Ethanolamine permease" in subsystem Ethanolamine utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2SZ93 at UniProt or InterPro

Protein Sequence (467 amino acids)

>BPHYT_RS00100 ethanolamine permease (Burkholderia phytofirmans PsJN)
MKSESTNQHVGKVTHHELKQTLGTWQLWGIAVGLVISGEYFGWSYGWASAGTLGFVITAI
FIAAMYTTFIFSFTELTTSIPHAGGPFAYARHAFGPTGGYLAGAATLVEFVFAPPAIALA
IGAYLHVQFPGLEPKHAAMGAYLIFMALNIVGVQIAAAFELCVTLLAIFELLVFMGVVSP
GFQWSNFTKGGWAGADNFSMGSFHGMFAAIPFAIWFFLAIEGVAMAAEEAKNPKRSIPIA
YVAGILTLVVLAIGVMVFAGAAGDWTKLSNINDPLPQAMKYIVGEHSGWMHMLVWLGLFG
LVASFHGIILGYSRQIFALARAGYLPEWLSKVHPRFKTPHRAIIAGGVVGIAAIYSDELI
QFGGQTLTANIVTMSVFGAIVMYIISMLSLFKLRRTEPNMERPFRAPLFPVFPAFALVAA
VICLATMVYFNFLVAIVFAIFLALGYVYFLMTRHQREAAPADALLEE