Protein Info for BBR_RS20400 in Bifidobacterium breve UCC2003

Annotation: serine/threonine protein kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 733 transmembrane" amino acids 220 to 238 (19 residues), see Phobius details amino acids 512 to 528 (17 residues), see Phobius details amino acids 532 to 552 (21 residues), see Phobius details amino acids 593 to 616 (24 residues), see Phobius details amino acids 636 to 658 (23 residues), see Phobius details amino acids 705 to 729 (25 residues), see Phobius details PF00069: Pkinase" amino acids 21 to 242 (222 residues), 113.9 bits, see alignment E=1.8e-36 PF01163: RIO1" amino acids 35 to 184 (150 residues), 22.3 bits, see alignment E=1.8e-08 PF07714: PK_Tyr_Ser-Thr" amino acids 79 to 224 (146 residues), 45.3 bits, see alignment E=1.4e-15

Best Hits

KEGG orthology group: None (inferred from 72% identity to bln:Blon_2481)

Predicted SEED Role

"COG0515: Serine/threonine protein kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (733 amino acids)

>BBR_RS20400 serine/threonine protein kinase (Bifidobacterium breve UCC2003)
MEGMSDLNALNLEPGEVVGGYTLVSRLGAGAMGSVWRVRDDGGTTYAMKILRDSLADESG
TSNSANTAAHDPDLKPNITPRERLRREAMALKKVNHPGVCGIVDMELDDSLAFIVTELIE
GRNLKEDVEVNGRYIGDDLERLARKLIDATKAVHAAGIVHRDIKPTNVMVSAAGPVLVDF
GIAMGEGESHVTRTGLVMGTPGFIAPEIIDGAESDEMTDWWSVASVLAFAAIGAPVFGTK
PMMAVLEREASGNANLTGLPAGTMAAFRSALNPDRSKRCMPDQLLNAIAVDALDPSVWQG
TQAGPFAAGAIAGTAATIAADAVGTEAMPPFGATADADSDNPRAIWRQDDYATAAIDSSS
SPTLSDGTATEAFPATTNAGSNLSSDDEATQLVGNATENATEAIRPAAQRTVPISDEPPV
APTTPLSERTAVLPAPQPVPQPLQPTPQPVPLGQNGWNPADGQSTAVDPAIRPALQHVIN
QTAQCVPTEALIQGPPAPNPADVRRGMYLQRGVLPLFLFAVPLAVLAASFPLIALIAAEI
LLWLLLTLAYNTESQLEREGRRGGKRKSSDSLIRVATLPWHIVKALLLSIPKLLLLTIVY
LAGIAVAVAALGLPVRTISWYFTASRGVPVPLLDDIPFSVSGLALGGFMAIGWLITVFGP
QSAMPRLGAGVLRGIRHNDLEPMAQPGADGLPAASIPRQGSRGTVLLTLWIIITLVLCAL
PLLGMPISWVPLA