Protein Info for BBR_RS19845 in Bifidobacterium breve UCC2003

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 601 transmembrane" amino acids 36 to 57 (22 residues), see Phobius details amino acids 73 to 91 (19 residues), see Phobius details amino acids 152 to 171 (20 residues), see Phobius details amino acids 177 to 196 (20 residues), see Phobius details amino acids 267 to 300 (34 residues), see Phobius details PF00664: ABC_membrane" amino acids 44 to 305 (262 residues), 145.4 bits, see alignment E=3e-46 PF00005: ABC_tran" amino acids 371 to 519 (149 residues), 106.7 bits, see alignment E=1.6e-34

Best Hits

Swiss-Prot: 43% identical to YKNV_BACSU: Uncharacterized ABC transporter ATP-binding protein YknV (yknV) from Bacillus subtilis (strain 168)

KEGG orthology group: K06147, ATP-binding cassette, subfamily B, bacterial (inferred from 88% identity to bln:Blon_2407)

Predicted SEED Role

"probable permease protein of ABC transporter system"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (601 amino acids)

>BBR_RS19845 ABC transporter ATP-binding protein (Bifidobacterium breve UCC2003)
MAQRNTFREDEELEESINLHDIARVGKYLKPYISRIVRILAVVVSMSCIVVSVPYLTKIM
IDDAIPNKDLGKLAMLAGGLFCLIVIYELALRYRTVAITRVGQLMLKDMRRDLFTHIQTL
PFSYFDSRPHGKILIRVVNYVNTLSDALSSGLINVFSDIFTFFVTLIVMFAIDWQLALWS
LVLFPVLIIWVRVLQYFQRKAYQVLSNKQSNLNAFIHESIAGVKTTQTFAREKEQFDTFQ
QQQDDVRTAWMAAKHIEFLMWPGVQTISVMTIAFIYFVGITGFGGVSVTTGMLIAFVGYA
NNFWNPVINIGNFYNQLVTCSAYLERIFETLDVKPEIANKPGATELPAIQGKVDFNDVVF
RYEDDGRNILNLVDFHVTPGKTIALVGPTGAGKTTIVSLLSRFYDVSEGSVTIDGHDVRD
VTLESLRRQMGVMLQDTFIFSGNVRDNIRYGKLDATDEEIEAAAKAVHAHEFIMELPDGY
DTTVEERGSTLSAGQRQLIAFARVLLADPRILILDEATSNIDTRTEEALQAGLRHLLKGR
TSFIIAHRLSTIENADQIFYIDHGQIVEHGTHAELLEAKGAYYRLYESQYAMIRVATGAT
E