Protein Info for BBR_RS19685 in Bifidobacterium breve UCC2003

Annotation: 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 159 PF02590: SPOUT_MTase" amino acids 1 to 158 (158 residues), 197.8 bits, see alignment E=5.3e-63 TIGR00246: rRNA large subunit m3Psi methyltransferase RlmH" amino acids 2 to 159 (158 residues), 163 bits, see alignment E=2.6e-52

Best Hits

Swiss-Prot: 98% identical to RLMH_BIFLO: Ribosomal RNA large subunit methyltransferase H (rlmH) from Bifidobacterium longum (strain NCC 2705)

KEGG orthology group: K00783, hypothetical protein (inferred from 98% identity to blo:BL1253)

Predicted SEED Role

"LSU m3Psi1915 methyltransferase RlmH" in subsystem Ribosome biogenesis bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (159 amino acids)

>BBR_RS19685 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH (Bifidobacterium breve UCC2003)
MQIDIIAPGRVKERYLRDAIDEYSKRLSRYCKLNIIEVADEKTLDHASEGVNRQIKAKEG
ERIAKHLKDGAFVIALAINGKQLSSEELAAKINDLGLRGTSHIQLVIGGSIGLDDAILRR
ADFLLSFSKMTFPHQLMRVILLEQIYRAYKINAGEPYHK