Protein Info for BBR_RS18640 in Bifidobacterium breve UCC2003

Annotation: PspC domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 428 transmembrane" amino acids 21 to 40 (20 residues), see Phobius details amino acids 46 to 66 (21 residues), see Phobius details amino acids 120 to 139 (20 residues), see Phobius details amino acids 145 to 163 (19 residues), see Phobius details amino acids 170 to 190 (21 residues), see Phobius details amino acids 203 to 224 (22 residues), see Phobius details PF04024: PspC" amino acids 15 to 69 (55 residues), 66.2 bits, see alignment 9.1e-23

Best Hits

KEGG orthology group: None (inferred from 84% identity to blo:BL1646)

Predicted SEED Role

"possible histidine kinase sensor of two component system"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (428 amino acids)

>BBR_RS18640 PspC domain-containing protein (Bifidobacterium breve UCC2003)
MTSIPEPLLPARMPLTRPKRGRWLTGVCKGIALHLGISVMWVRLAFIALTCLYGAGIIAY
VFLWIFMPAGDPQAVASAEHIPVEQAPLARGNQPAQAGVEDTAVSAESLSEAIQRAPKPA
LVALAGFVLLTIGLLLVGTGADSQLIIPLLLGLAGIALAWMNLSPNGTQLLSMLGGIALI
FIGWAIYVSNVTYVGWGTSPRRIMLSGFIMIACIVLAVMPWANAMLQRLSREQALKEREE
ERADMTAHLHDGVLQTLALIQLHFEDPSTVFTLARGQERELREWLYQERSTSDRSVSAGL
KQIAAEVEDEHGKPIEVVTVGDAHPSAQTDALLDATRQALVNAVTHGSEPISLYCEATDT
TVEVFVRDHGEGFDIDTIPPDRLGIRESIIGRIKRRGGTVEIVSRAGWGTEVRMHMPIAL
KSTQGEHR