Protein Info for BBR_RS16935 in Bifidobacterium breve UCC2003

Annotation: UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D- alanine ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 481 TIGR01143: UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase" amino acids 32 to 478 (447 residues), 380.6 bits, see alignment E=4.9e-118 PF01225: Mur_ligase" amino acids 32 to 96 (65 residues), 38.4 bits, see alignment E=1.9e-13 PF08245: Mur_ligase_M" amino acids 115 to 304 (190 residues), 144.6 bits, see alignment E=5.8e-46 PF02875: Mur_ligase_C" amino acids 326 to 414 (89 residues), 36.3 bits, see alignment E=8.5e-13

Best Hits

KEGG orthology group: K01929, UDP-N-acetylmuramoylalanyl-D-glutamyl-2,6-diaminopimelate--D-alanyl-D-alanine ligase [EC: 6.3.2.10] (inferred from 76% identity to bll:BLJ_1299)

Predicted SEED Role

"UDP-N-acetylmuramoylalanyl-D-glutamyl-2,6-diaminopimelate--D-alanyl-D-alanine ligase (EC 6.3.2.10)" in subsystem Methicillin resistance in Staphylococci or Peptidoglycan Biosynthesis (EC 6.3.2.10)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (481 amino acids)

>BBR_RS16935 UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D- alanine ligase (Bifidobacterium breve UCC2003)
MVPMSVEEIAKAVDGRLVAGDGSAIEATETVTDSRQAGSGAVFVAIKGERVDGHDFVDKV
ADQGAAAAIVDHEVACTTMPQIVVEDTVAALGLLAKHNIDRRRQLPGAFDLIGLTGSVGK
TTTKDLLSALLSTLGPTVAPIGSFNNEIGLPLTALRVNADTRFFVAEMGANHIGEIARLT
RIAPPNTVIVLRVGVAHLGEFGSRERIAQAKSEIVQGLLPGGTAVLNADDDYVVPMAQLA
SGDVLWFGQGHTHDSEVHADHIAADAADHAEFTMTDAHGEQVAVHLGIPGRHNVMNALAA
ATVALRYGMPLTAIAQTLAAQHTISPHRMALSTVSRQGASFELIDDSFNANPDSMKAGLD
GLRAWNANDGRQPFRVALLGAMLELGADERELHASVGEYAAGLGLDAIITVGSPSDAHLN
VLAESLAEGATRGRAASVDCVQTIDEAERIVLDLAKNHTDTVVLLKGSHASGLSALAERW
A