Protein Info for BBR_RS16750 in Bifidobacterium breve UCC2003

Annotation: ParA family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 279 PF10609: ParA" amino acids 26 to 271 (246 residues), 38.7 bits, see alignment E=2.8e-13 PF13614: AAA_31" amino acids 26 to 202 (177 residues), 210.6 bits, see alignment E=6.1e-66 PF09140: MipZ" amino acids 27 to 179 (153 residues), 36.8 bits, see alignment E=9.6e-13 PF01656: CbiA" amino acids 28 to 246 (219 residues), 82.2 bits, see alignment E=1.1e-26 PF06564: CBP_BcsQ" amino acids 28 to 177 (150 residues), 30.3 bits, see alignment E=1.1e-10 PF02374: ArsA_ATPase" amino acids 31 to 153 (123 residues), 37 bits, see alignment E=8.1e-13 PF00142: Fer4_NifH" amino acids 33 to 274 (242 residues), 43.6 bits, see alignment E=9.6e-15

Best Hits

Swiss-Prot: 53% identical to Y1708_MYCTU: Uncharacterized protein Rv1708 (Rv1708) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K03496, chromosome partitioning protein (inferred from 92% identity to bll:BLJ_1231)

Predicted SEED Role

"Chromosome (plasmid) partitioning protein ParA" in subsystem Bacterial Cytoskeleton or Plasmid replication or Two cell division clusters relating to chromosome partitioning

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (279 amino acids)

>BBR_RS16750 ParA family protein (Bifidobacterium breve UCC2003)
MPTDFLGREYETFPAPEPLQQHGPARVIAMCNQKGGVGKTTSSINIAGALAQYGRRVLIV
DFDPQGAATVGLGINANTVESTIYTALFDMSVDPHDVVQHTAFDNIDVIPANIDLSAAEV
QLVTEVGREQILNGVLRKLKAEYDVIIVDCQPSLGLLTVNALAAADGVIIPVAAEFFALR
GVALLMQSIEKVQSRINPALEVYGVLVTMYTNTLHCEEVCQRIYEAFENKVFHTFISRSI
KLPDSSVAAAPIVIYAPGHKTAKEYREVARELVSRGIVA