Protein Info for BBR_RS16585 in Bifidobacterium breve UCC2003

Annotation: BAX inhibitor (BI)-1/YccA family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 273 transmembrane" amino acids 63 to 83 (21 residues), see Phobius details amino acids 85 to 90 (6 residues), see Phobius details amino acids 92 to 114 (23 residues), see Phobius details amino acids 126 to 145 (20 residues), see Phobius details amino acids 151 to 170 (20 residues), see Phobius details amino acids 182 to 200 (19 residues), see Phobius details amino acids 206 to 225 (20 residues), see Phobius details amino acids 246 to 267 (22 residues), see Phobius details PF01027: Bax1-I" amino acids 58 to 269 (212 residues), 153 bits, see alignment E=4.9e-49

Best Hits

KEGG orthology group: K06890, (no description) (inferred from 76% identity to blj:BLD_0272)

Predicted SEED Role

"FIG00424978: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (273 amino acids)

>BBR_RS16585 BAX inhibitor (BI)-1/YccA family protein (Bifidobacterium breve UCC2003)
MTFGQQPQNNGQYNPQYNTSDYNTAQQNYQYAAQGTGAGTAAINTTMTYSYEEARRASVT
KVYGEMTIGVIVTAIVAFIGQMTGAYYAFLASTGAIGLIALCVVQVGLAVVLGARVTKMK
SGTARVMFYVYAALMGFTLSSIFMVYSLGSIVTALGITAAFFFALTMFGMTTKINMLKAG
PILMIGLIVLIISQLVLMFLHVDGMTQIVCALGLILFAGMTIYDAQSTRALLSQYEAQGP
EMVKRVSILCALNLYLDFVNMFLYILQLLGNRD