Protein Info for BBR_RS16570 in Bifidobacterium breve UCC2003

Annotation: tRNA (N6-isopentenyl adenosine(37)-C2)-methylthiotransferase MiaB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 483 PF00919: UPF0004" amino acids 30 to 132 (103 residues), 91.3 bits, see alignment E=3.3e-30 TIGR00089: radical SAM methylthiotransferase, MiaB/RimO family" amino acids 30 to 469 (440 residues), 471.3 bits, see alignment E=2.7e-145 TIGR01574: tRNA-i(6)A37 thiotransferase enzyme MiaB" amino acids 30 to 468 (439 residues), 460.2 bits, see alignment E=7.8e-142 PF04055: Radical_SAM" amino acids 181 to 349 (169 residues), 99.7 bits, see alignment E=2.1e-32

Best Hits

Swiss-Prot: 85% identical to MIAB_BIFLS: tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase (miaB) from Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12)

KEGG orthology group: K06168, bifunctional enzyme involved in thiolation and methylation of tRNA (inferred from 85% identity to bln:Blon_0941)

Predicted SEED Role

"tRNA-i(6)A37 methylthiotransferase" in subsystem Ribosomal protein S12p Asp methylthiotransferase or tRNA processing

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (483 amino acids)

>BBR_RS16570 tRNA (N6-isopentenyl adenosine(37)-C2)-methylthiotransferase MiaB (Bifidobacterium breve UCC2003)
MNEDMMTEAERASIESDEHLTTQERGKGVFHIHTLGCQMNVHDSERIAGVLETDGYVPAT
EEQVNDHDLDLIVLNTCAVRENAAERMYGTVGLWAEMKRQRPNLQIAVGGCMAQLDRQKI
ANKAPWVAAVFGTKNIGDLPQLLNQNRATDTPQVKVDDQLQQFPSQLPAARASRVSSWVA
ISVGCNNTCTFCIVPTTRGKEKDRRPGDILDEVRQCVANGAKEVTLLGQNVNSFGYGIGD
RYAFSKLLRACGTIDGLERVRFTSPHPAAFTDDVIEAMAETPNVMHQLHMPLQSGSDKIL
RSMRRSYRASKFMTILEKVRQAMPDAQISTDIIVGFPGETEEDFQQTLDVVRQARFSSAF
TFIYSPRPGTPAAEMEQVPHDVVQDRFNRLVALQEQITAENLQSFEGRDVEVMITGTQGK
KDADTHRVTGREKTGVLVHIGVPEGQPMPQIGDFVTATVTHAGRHNLIADPDLAQGQTYS
VRH