Protein Info for BBR_RS16515 in Bifidobacterium breve UCC2003

Annotation: preprotein translocase subunit SecA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 900 960 PF07517: SecA_DEAD" amino acids 9 to 383 (375 residues), 427.2 bits, see alignment E=9.3e-132 TIGR00963: preprotein translocase, SecA subunit" amino acids 27 to 818 (792 residues), 1111.6 bits, see alignment E=0 PF00270: DEAD" amino acids 98 to 215 (118 residues), 29.4 bits, see alignment E=1.9e-10 PF01043: SecA_PP_bind" amino acids 233 to 340 (108 residues), 133 bits, see alignment E=2e-42 PF21090: P-loop_SecA" amino acids 399 to 608 (210 residues), 304.6 bits, see alignment E=9.7e-95 PF07516: SecA_SW" amino acids 613 to 829 (217 residues), 235.5 bits, see alignment E=1.8e-73 PF02810: SEC-C" amino acids 940 to 956 (17 residues), 29.8 bits, see alignment (E = 1.3e-10)

Best Hits

Swiss-Prot: 96% identical to SECA_BIFLD: Protein translocase subunit SecA (secA) from Bifidobacterium longum (strain DJO10A)

KEGG orthology group: K03070, preprotein translocase subunit SecA (inferred from 96% identity to blj:BLD_0287)

Predicted SEED Role

"Protein export cytoplasm protein SecA ATPase RNA helicase (TC 3.A.5.1.1)" (TC 3.A.5.1.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (960 amino acids)

>BBR_RS16515 preprotein translocase subunit SecA (Bifidobacterium breve UCC2003)
MVDIVDKALRMGEGHQLKKLENVAKAVNALEDEISALSDEDLKAQTPKFKQQIENGKSLD
DIMPEAFATVREVSKRTLGQRHFDVQLMGGAALHWGNIAEMKTGEGKTLVATLPTYLNAL
EGKGVHVVTVNDYLASYQSELMGRIYRFLGMNVGCIITDQKPPERRKQYNADITYGTNNE
FGFDYLRDNMAWEKADLVQRGHHYAIVDEVDSILIDEARTPLIISGPAEGDVTRWYRQFA
KLVLKLTRDEDYDVDEKKKVVGILDPGITKVEDFLGIDNLYEPANTALIGYLNNAIKAKE
LFLKDKDYVVTQGEVLIVDEHTGRILPGRRYNEGLHQAIEAKEGVEVKAENQTFATITLQ
NYFRMYDKLAGMTGTAETEAAEFMNTYKLGVLPIKTNKPMIRKDQDDLIFRTKKEKLAAI
VKDVAKRHAKGQPVLLGTASVESSEVVSTLLDVAKIPHQVLNAKQHEKEAAVVAVAGRKG
AVTVATNMAGRGTDIMLGGNVEFLADAKLKSEGYSPEDTPEEYEKRWPGTLNEIKAQVKD
EHEEVKELGGLYVLGTERHESRRIDNQLRGRSGRQGDPGESRFYLSLEDDLMRLFNTQLV
AQVMAKGMEEGQPIEAKSVTKGVRTAQKAVESRNYEIRKNVLKYDDVMNKQRTVIYSERQ
AVLKGEDIHKDILRFISDTVESYIKGANKGSEKPKDWDWEGLFKALNTVIPTKVDEDEAR
KIVGGLKGAKAVEAVRDLIVEDARQQYGEMEETIGETGLRDLERRVVLAVLDRKWREHLY
EMDYLKDGIGLRGMGQRDPLVEYQREGYQMYNSMIEAIKEESVQLLFHIDVKQVASTEDA
VDEVEESDETADSVTVATGPDENGESEVEAAEGEVEEEDAKQAIAESAAVSESGESTLPV
AGPAPISHAEGKVPANKRPKSDELKTPWADGRTFPGTGKNAPCPCGSGRKYKMCHGQNEK