Protein Info for BBR_RS16055 in Bifidobacterium breve UCC2003

Annotation: amino acid permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 526 transmembrane" amino acids 69 to 89 (21 residues), see Phobius details amino acids 95 to 116 (22 residues), see Phobius details amino acids 135 to 157 (23 residues), see Phobius details amino acids 177 to 198 (22 residues), see Phobius details amino acids 210 to 232 (23 residues), see Phobius details amino acids 252 to 273 (22 residues), see Phobius details amino acids 294 to 314 (21 residues), see Phobius details amino acids 336 to 358 (23 residues), see Phobius details amino acids 384 to 405 (22 residues), see Phobius details amino acids 411 to 436 (26 residues), see Phobius details amino acids 457 to 477 (21 residues), see Phobius details amino acids 483 to 501 (19 residues), see Phobius details PF00324: AA_permease" amino acids 67 to 512 (446 residues), 424.9 bits, see alignment E=3.9e-131 PF13520: AA_permease_2" amino acids 70 to 479 (410 residues), 125 bits, see alignment E=4e-40

Best Hits

Swiss-Prot: 62% identical to YBGF_BACSU: Uncharacterized amino acid permease YbgF (ybgF) from Bacillus subtilis (strain 168)

KEGG orthology group: K03293, amino acid transporter, AAT family (inferred from 96% identity to bln:Blon_1427)

MetaCyc: 57% identical to CP4-6 prophage; S-methyl-L-methionine transporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-486

Predicted SEED Role

"Amino acid transporters"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (526 amino acids)

>BBR_RS16055 amino acid permease (Bifidobacterium breve UCC2003)
MSQPDTDMAKQSPSSQQETRIRMDAPQHKPNQADESSALGEQSTEPTGQHNKHALHTNLK
RGMESRHLQMISLGGVIGTGLFLSSGYTIQQAGPIGTILAYSIGALIVYLVMLTLGELSV
AMPVTGSFHVYAEEFIGPGTGFVIAIQYWLTWTVALGSEFTAAGLLMQRWFPDSPTWVWS
AACIILIFTLNALSVRFFAEAEFWFASIKVFAICAFIIIGLLAIFGIIPIAGYQHAPMFG
NLVKDGIFPNGFVPVFATILTVNFAFSGTELIGVTAGETRDPETAVPKAIHTTLWRLVLF
FIGSITVMCALIPWRQAGVGESPFVLVFNSIGIPYAGDIMNFVVLTAVLSASNSGLYAST
RMVWSMGNEGMIPRWFAKTNRCGVPMLALCAAMAGGLLALLSSVIAASTVYLVLVALSGL
SAVVVWIAIAYCQIVFRRRWLASGHSADELKYRTPGYPYVSWAAFILCTASFILVIFDVE
QRFALVAELVFIVVCYGIYFLQQWWRKRRKASDSEDDLSMPWANQR