Protein Info for BBR_RS14860 in Bifidobacterium breve UCC2003

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 456 transmembrane" amino acids 32 to 57 (26 residues), see Phobius details amino acids 65 to 87 (23 residues), see Phobius details amino acids 103 to 131 (29 residues), see Phobius details amino acids 162 to 182 (21 residues), see Phobius details amino acids 188 to 208 (21 residues), see Phobius details amino acids 259 to 281 (23 residues), see Phobius details amino acids 309 to 329 (21 residues), see Phobius details amino acids 336 to 354 (19 residues), see Phobius details amino acids 359 to 378 (20 residues), see Phobius details amino acids 390 to 414 (25 residues), see Phobius details amino acids 420 to 441 (22 residues), see Phobius details PF07690: MFS_1" amino acids 34 to 409 (376 residues), 87.8 bits, see alignment E=6.9e-29 PF05977: MFS_3" amino acids 35 to 434 (400 residues), 30.7 bits, see alignment E=1.2e-11

Best Hits

KEGG orthology group: K08217, MFS transporter, DHA3 family, macrolide efflux protein (inferred from 96% identity to bln:Blon_1644)

Predicted SEED Role

"Macrolide-efflux protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (456 amino acids)

>BBR_RS14860 MFS transporter (Bifidobacterium breve UCC2003)
MPVASDGVDGPGAYAGAMSNEEADAAWIRRAALLLVGQAFSLLGSSIVQYAIWWWIVLQT
RTGSAMLLATLFGVVPQAVVSIFGGSWADRHNRKLLIMLPDMVIAAVTVVLSLGFAMGWA
GLATIFVVLLIRSAGGGIQTPAVQSFIPDVVPSGKLLRVNSIYGVINSANMIVAPAVAAV
LINMVPLWSILLIDVTTAVIGVGFVALIKVPKRRATAERPAHVAPEGEGRSPLVGVRRVF
ADLKVGFDYAWHRPNLRNVVLGDALTCFIAVAPMNLTLLLMTREYEGIDLNLGFINLTTA
SDKLAANELGWSIGMLLGGAFMSTIGAKVVRDNMRMVALGVTLVGVTVVGLGVAPNLLAY
LFVDVANGVASAICVGPMRTIMQTESDEHVVGRVFGLDTTLSTLGMPLGMLVFAPLADLI
PISLVFVIGGVLTLPIGVYLFGQTRRRAGAVPDRGR