Protein Info for BBR_RS14630 in Bifidobacterium breve UCC2003

Annotation: glutamine-binding protein glnH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00497: SBP_bac_3
  • amino acids 52 to 264 (213 residues), 184.1 bits, E=2.7e-58
• PF10613: Lig_chan-Glu_bd
  • amino acids 95 to 142 (48 residues), 33.6 bits, 3.7e-12

Best Hits

KEGG orthology group: K02030, polar amino acid transport system substrate-binding protein (inferred from 63% identity to lca:LSEI_A12)

Predicted SEED Role

"Lysine-arginine-ornithine-binding periplasmic protein precursor (TC 3.A.1.3.1)" in subsystem Arginine and Ornithine Degradation (TC 3.A.1.3.1)

Protein Sequence (283 amino acids)

>BBR_RS14630 glutamine-binding protein glnH (Bifidobacterium breve UCC2003)
MFNVKKALAGVLAGVTLISVAACGNGPDPAAGGGSSSQQGQTVEQIKKTGKIRIATFGDL
PPYGYVKNDGTRAGYDVALGNQIGKDLGVKVDWVQVNADGRVDSLKSDKVDLVLANFTVT
DERKQVVDFADPYMKVSIGVVSPDSAKITSADQLKGKQLAVTKGTTAEAFFTEKYPDVQL
QKFDSKTQQFQAFKDGRVAALADDNTYLYAWAKDNPGYTVGIKTIGDESTIAPAVKKGNK
SLLEWTNKEIKTLTSNGFFKDAYQSELAPSFTSDIKPEDVIIE