Protein Info for BBR_RS12080 in Bifidobacterium breve UCC2003

Annotation: NAD(P)-dependent glycerol-3-phosphate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 333 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF02737: 3HCDH_N" amino acids 4 to 83 (80 residues), 22.9 bits, see alignment E=2.5e-08 PF03446: NAD_binding_2" amino acids 4 to 98 (95 residues), 22.5 bits, see alignment E=3.7e-08 PF01210: NAD_Gly3P_dh_N" amino acids 4 to 161 (158 residues), 154.9 bits, see alignment E=6e-49 PF03807: F420_oxidored" amino acids 4 to 108 (105 residues), 33.5 bits, see alignment E=1.9e-11 PF02558: ApbA" amino acids 5 to 113 (109 residues), 46.9 bits, see alignment E=7.9e-16 PF07479: NAD_Gly3P_dh_C" amino acids 182 to 322 (141 residues), 156.6 bits, see alignment E=1.7e-49 PF20618: GPD_NAD_C_bact" amino acids 242 to 305 (64 residues), 60.3 bits, see alignment E=7.3e-20

Best Hits

Swiss-Prot: 90% identical to GPDA_BIFLS: Glycerol-3-phosphate dehydrogenase [NAD(P)+] (gpsA) from Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12)

KEGG orthology group: K00057, glycerol-3-phosphate dehydrogenase (NAD(P)+) [EC: 1.1.1.94] (inferred from 90% identity to bln:Blon_0319)

Predicted SEED Role

"Glycerol-3-phosphate dehydrogenase [NAD(P)+] (EC 1.1.1.94)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization or Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 1.1.1.94)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.94

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (333 amino acids)

>BBR_RS12080 NAD(P)-dependent glycerol-3-phosphate dehydrogenase (Bifidobacterium breve UCC2003)
MGRKITVLGAGAWGTAFGQVLADAGNDVTMWAREPEIVEDIRDNRRNGVRLPSVKKLPDA
ITATGNRAEAVKDADIVVVAIAAQFARVALVEFRGLIPEHAIVVSLMKGIERNTNKRMDE
VVRETLDLPADRFAAISGPNLSKEIADRHPAATVVACENIDNATIVAEACTTKYFKAFVT
TDVIGLEMCGSLKNVTALAVGMARGAGYGENTAAMIETRGLAELAALGAAAGADPKTFFG
LAGVGDLIATCGSPLSRNYTFGSNLGKGLSVEEATKVSNGVAEGVPTTDAVVALGNQLDV
PTPLAYQMSRVLNEGIPCAEMLAGLFGREITVE