Protein Info for BBR_RS11630 in Bifidobacterium breve UCC2003

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 401 transmembrane" amino acids 14 to 35 (22 residues), see Phobius details amino acids 47 to 68 (22 residues), see Phobius details amino acids 80 to 98 (19 residues), see Phobius details amino acids 104 to 123 (20 residues), see Phobius details amino acids 140 to 161 (22 residues), see Phobius details amino acids 173 to 191 (19 residues), see Phobius details amino acids 222 to 247 (26 residues), see Phobius details amino acids 259 to 280 (22 residues), see Phobius details amino acids 291 to 311 (21 residues), see Phobius details amino acids 317 to 337 (21 residues), see Phobius details amino acids 350 to 371 (22 residues), see Phobius details amino acids 377 to 395 (19 residues), see Phobius details PF07690: MFS_1" amino acids 25 to 345 (321 residues), 76.3 bits, see alignment E=1.1e-25

Best Hits

KEGG orthology group: None (inferred from 98% identity to bln:Blon_0245)

Predicted SEED Role

"major facilitator superfamily MFS_1"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (401 amino acids)

>BBR_RS11630 MFS transporter (Bifidobacterium breve UCC2003)
MIQRYSQGMSARRIFPILLIAEGLCLSGMSVDLTITSLAGSSLAPAPWMATFPIACIFIG
TVIGTPAMGRLVGRFGYRQVFVFGALLAVLGGISSATALRFHQFPLLCIGTFCVGIYQSG
TNYYRYAAADSMPGKESKAINGILSAGAIASIIGPVLATFFGTATSIEYEGSYYVVSVLA
ACAVIVLLVLPKIQSPTPSHMRDKAIASTTPNYPALLTRPRFVLGATISFVASFVMVLVM
SGAPIVLESTFSQNAQTRMVAMQLHMVGMYLPTLFAIFIFHKKNSEMAQALTGLIVGMLG
TVVALAASASYAVTLDLLLIGISWSLCYAAGSALLTKSYAESERSWARGVGELAPVLGQV
LGSVLAGVLLAAGWKTVFVTVLAMIVCALIAMAGYRNKIKS