Protein Info for BBR_RS10815 in Bifidobacterium breve UCC2003

Annotation: sugar ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 373 transmembrane" amino acids 30 to 54 (25 residues), see Phobius details amino acids 66 to 84 (19 residues), see Phobius details amino acids 103 to 124 (22 residues), see Phobius details amino acids 136 to 157 (22 residues), see Phobius details amino acids 183 to 206 (24 residues), see Phobius details amino acids 238 to 258 (21 residues), see Phobius details amino acids 303 to 324 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 104 to 328 (225 residues), 49.3 bits, see alignment E=2.4e-17

Best Hits

KEGG orthology group: K10241, cellobiose transport system permease protein (inferred from 74% identity to bde:BDP_0138)

Predicted SEED Role

"sugar ABC transporter, permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (373 amino acids)

>BBR_RS10815 sugar ABC transporter permease (Bifidobacterium breve UCC2003)
MTARQSHGQAKSKQDWHSRLEMFEWKASPYLYIAPFFILFLIVGLFPLLYTMWIATRQFN
TLTGDAGFAVCGSTCGTTNASWFGNFMWVLHQPTFYVALRNSVSIFLLSSVPQIIIALWL
AWVLDANLKAKTFWRMGVLLPYIVAPSAAGIIFSQVFSDKMGAINVLLQQIGMQPIMWHG
NTFWSHVAIATIVNWRYIGYNTLILLAAMQAIPRDVLEAAVVDGAGKWRTFRSVTLPMLR
PTLIFVIITSTIGGLQIFDEPQMFHNGASAGGGANNQYLTVSLYLYKLGFVSVTPGQPNL
GRAAAVAWILFLIVVAISLLNYALTQRLATGGQSRESKEAARLSAQRDEAERQKAIRTGV
NGRMDAQQVAERK