Protein Info for BBR_RS10770 in Bifidobacterium breve UCC2003

Annotation: CrcB family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 131 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 39 to 61 (23 residues), see Phobius details amino acids 70 to 88 (19 residues), see Phobius details amino acids 103 to 128 (26 residues), see Phobius details PF02537: CRCB" amino acids 4 to 122 (119 residues), 77.6 bits, see alignment E=4.3e-26

Best Hits

Swiss-Prot: 98% identical to CRCB1_BIFLO: Putative fluoride ion transporter CrcB 1 (crcB1) from Bifidobacterium longum (strain NCC 2705)

KEGG orthology group: K06199, CrcB protein (inferred from 97% identity to bln:Blon_0126)

Predicted SEED Role

"CrcB protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (131 amino acids)

>BBR_RS10770 CrcB family protein (Bifidobacterium breve UCC2003)
MMWMICLFGGLGAMARYVLDVSIQRGWNRENRRTNRSFPLSTLVINGVASLCAGIAMMSY
YSQSVDMDTVMMFVVGFLGGFSTFSTALNEVVSLIRQRRFTLALGYGIATVAVPLICVAT
GFGIALLANPA