Protein Info for BBR_RS10715 in Bifidobacterium breve UCC2003

Annotation: tRNA-guanine(34) transglycosylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 437 TIGR00449: tRNA-guanine family transglycosylase" amino acids 45 to 425 (381 residues), 402.3 bits, see alignment E=1.8e-124 TIGR00430: tRNA-guanine transglycosylase" amino acids 46 to 425 (380 residues), 410 bits, see alignment E=8.9e-127 PF01702: TGT" amino acids 46 to 426 (381 residues), 397.5 bits, see alignment E=2.7e-123

Best Hits

KEGG orthology group: K00773, queuine tRNA-ribosyltransferase [EC: 2.4.2.29] (inferred from 97% identity to blb:BBMN68_1290)

Predicted SEED Role

"tRNA-guanine transglycosylase (EC 2.4.2.29)" in subsystem Queuosine-Archaeosine Biosynthesis (EC 2.4.2.29)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.29

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (437 amino acids)

>BBR_RS10715 tRNA-guanine(34) transglycosylase (Bifidobacterium breve UCC2003)
MTNDLLNHPLGAQDGQPGDRSAFHFETITRLPSTANGLGRDGARYGRTGIIHTPHGDIRT
PAFVPVGTQAAMKAVLPEQMKELGAQCLLANAFHLFERPGEDVLDAAGGLARFMNWDGPT
FTDSGGFQVMSLGVGFKKTLAMDVTGMKSDDIIAKGKERMAWVDEDGVTFKSPLNGDAHR
FSAEISMGIQHKIGADIMFAFDELTTLMNTRSYQEDSVERTFRWARRCVEEHQRLTAARL
GKPYQALYGVVQGANYEDLRRRAASQIASLDFDGVGIGGAIEKRIIGDTCAWICDTMPES
RPRHVLGIASVDDIFACVENGGDTFDCVAPARCARNGAIYTRAGRYNIKRAQHKFDFGPL
EEGCDCYTCQHYSRAYVDHLLRAREFNGFTLATIHNEHFFVKLLDDIRASIDGGYFDEFR
DEALAHFYGNGERKPGL