Protein Info for BBR_RS10305 in Bifidobacterium breve UCC2003

Annotation: Conserved hypothetical membrane spanning protein, VanZ family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 361 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 43 to 65 (23 residues), see Phobius details amino acids 100 to 121 (22 residues), see Phobius details amino acids 128 to 152 (25 residues), see Phobius details amino acids 166 to 187 (22 residues), see Phobius details amino acids 208 to 236 (29 residues), see Phobius details amino acids 256 to 278 (23 residues), see Phobius details amino acids 307 to 328 (22 residues), see Phobius details amino acids 334 to 352 (19 residues), see Phobius details PF04892: VanZ" amino acids 53 to 183 (131 residues), 79.8 bits, see alignment E=1.5e-26

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (361 amino acids)

>BBR_RS10305 Conserved hypothetical membrane spanning protein, VanZ family (Bifidobacterium breve UCC2003)
MLTYLGYFSTSFTIAIVMWPILSAVLTLPILAGLYHRHHRMKLLSAGAAYLTVLYVLGLI
TFTLYPMPDDPEAFCAANAGQFAPQLDPLRFISDIQNGGLSGILQLVMNVVLFMPLGFVL
TRWLRWRWWAVLIGGFAVSLFIESSQLSGFWGLYPCAYRQFDVNDLMTNTLGAMAGLAVA
VLFGKWVPLAHMPERSEYNEHPGAVHRLVTFIIDMVFVALVYVPLTLLVTFLFYWAAEPL
QNGDFMLFGGHLTVGVGWLNFLAPIGASLAFLIFEFLIPLGHKGRTLGGMYTHMTIETKP
RKGIARAVFYILRTLIMGAMVVMFIIGFGHNAHIMHYTFYGFVILFLFAVFAHRMPWDFV
P