Protein Info for BBR_RS10265 in Bifidobacterium breve UCC2003

Annotation: DNA replication and repair protein RecF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 385 TIGR00611: DNA replication and repair protein RecF" amino acids 1 to 368 (368 residues), 272.2 bits, see alignment E=3.7e-85 PF02463: SMC_N" amino acids 3 to 354 (352 residues), 71.4 bits, see alignment E=7.6e-24 PF13476: AAA_23" amino acids 5 to 95 (91 residues), 34.9 bits, see alignment E=2.5e-12

Best Hits

Swiss-Prot: 84% identical to RECF_BIFLS: DNA replication and repair protein RecF (recF) from Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12)

KEGG orthology group: K03629, DNA replication and repair protein RecF (inferred from 84% identity to bll:BLJ_0003)

Predicted SEED Role

"DNA recombination and repair protein RecF" in subsystem DNA repair, bacterial RecFOR pathway

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (385 amino acids)

>BBR_RS10265 DNA replication and repair protein RecF (Bifidobacterium breve UCC2003)
MHISRLALDHYRSWSQVVVDFVPGVNILVGKNGLGKTNLVEAVEVLSTGASHRASSMLPL
IERGQTTATIRANVVDDDGQSTTYEASIHARGANRARINSGTSLYLRDIIGRIPSVSFTP
EDQRLVSGDPGARRTLLNQAGALLEPGYMQSLHQFTRIGKQRATLLKQLGASANTGQPVD
AVLSGLEIWTGQFIEAGVELTRMRARVIDLLAEPFAALYAELTGNDDTVSLTYAPSFDEV
LMQDDPRLSISEHFQRIYPGEVARGVNLIGPQRDDLTLNLADMPAREFASNGEMWTMALA
LKMALFQVIRQRLGLRPIVILDDVFAQLDDNRRTQILDFARRQDQVLITVASEGDVPTHE
SDNVLDIAQLMPSAAQSGGGSETQS