Protein Info for BBR_RS10255 in Bifidobacterium breve UCC2003

Annotation: chromosomal replication initiator protein DnaA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 488 TIGR00362: chromosomal replication initiator protein DnaA" amino acids 16 to 481 (466 residues), 487.8 bits, see alignment E=1.7e-150 PF00308: Bac_DnaA" amino acids 146 to 368 (223 residues), 287.8 bits, see alignment E=1.4e-89 PF01695: IstB_IS21" amino acids 182 to 288 (107 residues), 39.1 bits, see alignment E=1.3e-13 PF00004: AAA" amino acids 182 to 307 (126 residues), 26.9 bits, see alignment E=1.2e-09 PF08299: Bac_DnaA_C" amino acids 395 to 462 (68 residues), 104.8 bits, see alignment E=3.9e-34

Best Hits

Swiss-Prot: 88% identical to DNAA_BIFLS: Chromosomal replication initiator protein DnaA (dnaA) from Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12)

KEGG orthology group: K02313, chromosomal replication initiator protein (inferred from 88% identity to bll:BLJ_0001)

Predicted SEED Role

"Chromosomal replication initiator protein DnaA" in subsystem DNA-replication

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (488 amino acids)

>BBR_RS10255 chromosomal replication initiator protein DnaA (Bifidobacterium breve UCC2003)
MVDVSGDPTIEAAHIWSNTLTLLKRNSTLTAREKGWLEGIVPEGVFGSTIVLCVDNNDTL
QAIQGNLNESLLQALHTATGENMFPAFKVVPRSEPQPVSPYPTNASPTLTDFGKEPYGAP
EPVIPAVEQQFSVPQQKMNRDPETHLNKSFTFDSFVPGDSNRFARTVALAVAEGSGQDFN
PLCIYGGSGLGKTHLLNAIGNYALVKDPGLKVRYVTSEEFTNDFIDALQNTNQSQGQIAE
FNRRYRQVDVLLIDDIQFLGGKEATLDQFFHTFNSLHQANKRIVIASDVAPKNLKGFEAR
LISRFESGLTVDVKPPDLETRIAILRMIAAMNGSKIPNDVLDLIAERFTENIRELEGALT
RVTAVASLSNQPVTRALAEQTLQDFFTTDVEIKPTDIIGQVAKYFHLTFEDIVGSSRTKN
VVIPRQIAMYLAREMTSMSLMDIGEVFGGRDHTTVMHACTRIGDKMQQKQEIYNYVMELT
VRLKQNAD