Protein Info for Ac3H11_737 in Acidovorax sp. GW101-3H11

Annotation: Alpha/beta hydrolase fold

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 307 PF00561: Abhydrolase_1" amino acids 33 to 166 (134 residues), 95.6 bits, see alignment E=6.1e-31 PF12697: Abhydrolase_6" amino acids 35 to 294 (260 residues), 48.2 bits, see alignment E=3.5e-16 PF12146: Hydrolase_4" amino acids 35 to 151 (117 residues), 29.9 bits, see alignment E=5.3e-11

Best Hits

Swiss-Prot: 45% identical to DEHA_RHOPA: Fluoroacetate dehalogenase (RPA1163) from Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)

KEGG orthology group: K01561, haloacetate dehalogenase [EC: 3.8.1.3] (inferred from 67% identity to lch:Lcho_3194)

MetaCyc: 45% identical to fluoroacetate dehalogenase monomer (Moraxella sp. B)
Haloacetate dehalogenase. [EC: 3.8.1.3]

Predicted SEED Role

"Alpha/beta hydrolase fold"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.8.1.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165JBJ9 at UniProt or InterPro

Protein Sequence (307 amino acids)

>Ac3H11_737 Alpha/beta hydrolase fold (Acidovorax sp. GW101-3H11)
MTPSPWFEGFTPHRIATTGAEIFVRTGGTVGAPPLLLLHGFPQTHALWHRVAQQLARDYF
LVLPDLRGYGDSSHAPGLPDHSNYSKRALAQDMAEVMTALGHNSFYLCGHDRGGRVAHRL
ALDHAARVKRLCVIDIAPTLDMYARTDMDFARAYYHWFHLIQPAPLPETMIGGNARAYLH
AKLGGWGSAGLAHIEPPALADYERCFCTPEAIHTACEDYRASAGIDLDHDRDSRARGDKI
ACDTLVIWGAHGVVHRLFDPLVLWQAQCAGVVSGQAVSAGHFIPEQLPGETADALRGFMR
EGQPAPR