Protein Info for Ac3H11_698 in Acidovorax sp. GW101-3H11

Annotation: Dipeptide-binding ABC transporter, periplasmic substrate-binding component (TC 3.A.1.5.2); Putative hemin-binding lipoprotein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 528 signal peptide" amino acids 1 to 36 (36 residues), see Phobius details PF00496: SBP_bac_5" amino acids 89 to 436 (348 residues), 221.7 bits, see alignment E=8.1e-70

Best Hits

KEGG orthology group: K02035, peptide/nickel transport system substrate-binding protein (inferred from 73% identity to pol:Bpro_0656)

Predicted SEED Role

"Dipeptide-binding ABC transporter, periplasmic substrate-binding component (TC 3.A.1.5.2); Putative hemin-binding lipoprotein" (TC 3.A.1.5.2)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165JWM8 at UniProt or InterPro

Protein Sequence (528 amino acids)

>Ac3H11_698 Dipeptide-binding ABC transporter, periplasmic substrate-binding component (TC 3.A.1.5.2); Putative hemin-binding lipoprotein (Acidovorax sp. GW101-3H11)
VQHPLPTLELRGRRNLLGAAALTAALTLACSTSWAQTAPATPSKGGAANLAMVGEPQGLD
PMVSTADLVGTIMQHVYEPLYTFDANWAIAPMLAEGLPTVSKDGLTYTIPLRKGVKFHNG
REMTADDVVASLQRWMELNPRGKAVGKEVASLTAKGALAVELKLKTPYAPLLAQLALPSG
MAAIMAKESIAPQLKDFVGTGPYQFKERRPDQFTVLVRFDGYASRKEAASGYAGKREALL
DELRFVPVPSANTRVEGALSGQFQYADLLPVEAIGRVEKGAPAVVPIVTKNFGFPYIVFN
TKEGVLASQPLRRAVQTAVGTGELLAAGFGDNRFFVVEPNFFPKGTPYYSDAGSKLYNER
NPQAAKEQTAKASYGGQPVRIMASRQYEFHYNMALVMSEQLKKAGFKTELQVVDWATLVQ
RRNDPKLWDVYFTHSGLFPEPMLSPPQLGDGAPGWWESDAKKSTLAAFNQETDPVKRGPL
WGKVQQVVYDEVPFIEVGKFNGLSARSAKLQGYTPAIWPFFWNTGLAK